Lineage for d1llca1 (1llc A:13-164)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1348919Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1348958Protein Lactate dehydrogenase [51859] (17 species)
  7. 1349022Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries)
  8. 1349051Domain d1llca1: 1llc A:13-164 [30176]
    Other proteins in same PDB: d1llca2
    complexed with afp, so4

Details for d1llca1

PDB Entry: 1llc (more details), 3 Å

PDB Description: structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1llca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llca1 c.2.1.5 (A:13-164) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
asitdkdhqkvilvgdgavgssyafamvlqgiaqeigivdifkdktkgdaidlsnalpft
spkkiysaeysdakdadlvvitagapkqpgetrldlvnknlkilksivdpivdsgfnlif
lvaanpvdiltyatwklsgfpknrvvgsg

SCOPe Domain Coordinates for d1llca1:

Click to download the PDB-style file with coordinates for d1llca1.
(The format of our PDB-style files is described here.)

Timeline for d1llca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1llca2