Lineage for d1ldb_2 (1ldb 163-331)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138998Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 138999Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 139000Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 139007Protein Lactate dehydrogenase [56339] (11 species)
  7. 139008Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 139017Domain d1ldb_2: 1ldb 163-331 [42141]
    Other proteins in same PDB: d1ldb_1

Details for d1ldb_2

PDB Entry: 1ldb (more details), 2.8 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

SCOP Domain Sequences for d1ldb_2:

Sequence, based on SEQRES records: (download)

>d1ldb_2 d.162.1.1 (163-331) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records): (download)

>d1ldb_2 d.162.1.1 (163-331) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpidlerifvnvrd
aayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyigvpavinr
ngirevieielnddeknrfhhsaatlksvlaraftr

SCOP Domain Coordinates for d1ldb_2:

Click to download the PDB-style file with coordinates for d1ldb_2.
(The format of our PDB-style files is described here.)

Timeline for d1ldb_2: