SCOP 1.55: Domain d1ldb_2: 1ldb 163-331

Lineage for d1ldb_2 (1ldb 163-331)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)

4. Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)

6. Protein Lactate dehydrogenase [56339] (8 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)

8. Domain d1ldb_2: 1ldb 163-331 [42141]
   Other proteins in same PDB: d1ldb_1

Details for d1ldb_2

PDB Entry: 1ldb, 2.8 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

SCOP Domain Sequences for d1ldb_2:

Sequence, based on SEQRES records:

>d1ldb_2 d.162.1.1 (163-331) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records):

>d1ldb_2 d.162.1.1 (163-331) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpidlerifvnvrd
aayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyigvpavinr
ngirevieielnddeknrfhhsaatlksvlaraftr

Timeline for d1ldb_2:

• d1ldb_2 appears in SCOP 1.57
  
• d1ldb_2 appears in the current release, SCOPe 2.07, called d1ldba2