| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Lactate dehydrogenase [56339] (19 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries) |
| Domain d1ldnb2: 1ldn B:163-330 [42134] Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1 complexed with fbp, nad, oxm |
PDB Entry: 1ldn (more details), 2.5 Å
SCOPe Domain Sequences for d1ldnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldnb2 d.162.1.1 (B:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft
Timeline for d1ldnb2: