Lineage for d1ldma2 (1ldm A:161-329)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047016Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1047017Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 1047018Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 1047025Protein Lactate dehydrogenase [56339] (15 species)
  7. 1047053Species Dogfish (Squalus acanthias) [TaxId:7797] [56342] (3 PDB entries)
  8. 1047054Domain d1ldma2: 1ldm A:161-329 [42127]
    Other proteins in same PDB: d1ldma1
    complexed with nad, oxm

Details for d1ldma2

PDB Entry: 1ldm (more details), 2.1 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase
PDB Compounds: (A:) m4 lactate dehydrogenase

SCOPe Domain Sequences for d1ldma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]}
sgcnldsarfrylmgerlgvhscschgwvigehgdsvpsvwsgmnvasiklhpldgtnkd
kqdwkklhkdvvdsayeviklkgytswaiglsvadlaetimknlcrvhpvstmvkdfygi
kdnvflslpcvlndhgisnivkmklkpneeqqlqksattlwdiqkdlkf

SCOPe Domain Coordinates for d1ldma2:

Click to download the PDB-style file with coordinates for d1ldma2.
(The format of our PDB-style files is described here.)

Timeline for d1ldma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ldma1