Lineage for d7diua_ (7diu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880120Species Plasmodium falciparum [TaxId:36329] [228276] (25 PDB entries)
  8. 3084850Domain d7diua_: 7diu A: [421167]
    automated match to d4n11a_
    complexed with cs, mpd, mpo, pt

Details for d7diua_

PDB Entry: 7diu (more details), 1.88 Å

PDB Description: structure of pfgrx1 in the intermediate state with platinum and cesium
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d7diua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7diua_ c.47.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
seavkkwvnkiieeniiavfaktecpycikaisilkgynlnshmhvenieknpdmaniqa
ylkeltgkssvprifinkdvvggcddlvkendegklkerlqklglv

SCOPe Domain Coordinates for d7diua_:

Click to download the PDB-style file with coordinates for d7diua_.
(The format of our PDB-style files is described here.)

Timeline for d7diua_:

  • d7diua_ is new in SCOPe 2.08-stable