Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (23 species) not a true protein |
Species Synechococcus sp. [TaxId:1980980] [420979] (1 PDB entry) |
Domain d7d6wb_: 7d6w B: [421117] automated match to d4h0mb_ complexed with cyc |
PDB Entry: 7d6w (more details), 2.15 Å
SCOPe Domain Sequences for d7d6wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d6wb_ a.1.1.3 (B:) automated matches {Synechococcus sp. [TaxId: 1980980]} tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
Timeline for d7d6wb_: