Lineage for d7b7sd1 (7b7s D:177-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 3084734Domain d7b7sd1: 7b7s D:177-309 [421051]
    Other proteins in same PDB: d7b7sa_, d7b7sc_
    automated match to d1gy3b1
    complexed with no3, sgm, so4, t1t

Details for d7b7sd1

PDB Entry: 7b7s (more details), 2.54 Å

PDB Description: cdk2/cyclin a2 in complex with 3h-pyrazolo[4,3-f]quinoline-based derivative hsd1368
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d7b7sd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b7sd1 a.74.1.1 (D:177-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav
nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmeh
lvlkvltfdlaap

SCOPe Domain Coordinates for d7b7sd1:

Click to download the PDB-style file with coordinates for d7b7sd1.
(The format of our PDB-style files is described here.)

Timeline for d7b7sd1:

  • d7b7sd1 is new in SCOPe 2.08-stable