| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
| Domain d7b7sd1: 7b7s D:177-309 [421051] Other proteins in same PDB: d7b7sa_, d7b7sc_ automated match to d1gy3b1 complexed with no3, sgm, so4, t1t |
PDB Entry: 7b7s (more details), 2.54 Å
SCOPe Domain Sequences for d7b7sd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7b7sd1 a.74.1.1 (D:177-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav
nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmeh
lvlkvltfdlaap
Timeline for d7b7sd1:
View in 3DDomains from other chains: (mouse over for more information) d7b7sa_, d7b7sb1, d7b7sb2, d7b7sc_ |