SCOPe 2.08: Domain d7b7sb1: 7b7s B:177-309

Lineage for d7b7sb1 (7b7s B:177-309)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d7b7sb1: 7b7s B:177-309 [420786]
   Other proteins in same PDB: d7b7sa_, d7b7sc_
   automated match to d1gy3b1
   complexed with no3, sgm, so4, t1t

Details for d7b7sb1

PDB Entry: 7b7s, 2.54 Å

PDB Description: cdk2/cyclin a2 in complex with 3h-pyrazolo[4,3-f]quinoline-based derivative hsd1368

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d7b7sb1:

Sequence; same for both SEQRES and ATOM records:

>d7b7sb1 a.74.1.1 (B:177-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav
nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmeh
lvlkvltfdlaap

Timeline for d7b7sb1:

• d7b7sb1 is new in SCOPe 2.08-stable