Class b: All beta proteins [48724] (180 folds) |
Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily) pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368) |
Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families) automatically mapped to Pfam PF13954 |
Family b.167.1.1: Usher N-domain [141730] (1 protein) N-terminal part of Pfam PF00577 |
Protein Outer membrane usher protein FimD [141731] (1 species) |
Species Escherichia coli [TaxId:562] [141732] (5 PDB entries) Uniprot P30130 46-170! Uniprot P30130 70-170! Uniprot P30130 70-184 |
Domain d7b0xd_: 7b0x D: [420769] Other proteins in same PDB: d7b0xc1, d7b0xc2, d7b0xc3, d7b0xi_ automated match to d1ze3d1 complexed with edo |
PDB Entry: 7b0x (more details), 1.7 Å
SCOPe Domain Sequences for d7b0xd_:
Sequence, based on SEQRES records: (download)
>d7b0xd_ b.167.1.1 (D:) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]} dlyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgi vpcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafm snr
>d7b0xd_ b.167.1.1 (D:) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]} dlyfnprflaavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgivpcl traqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafmsnr
Timeline for d7b0xd_:
View in 3D Domains from other chains: (mouse over for more information) d7b0xc1, d7b0xc2, d7b0xc3, d7b0xi_ |