SCOPe 2.08: Domain d7b0xd_: 7b0x D:

Lineage for d7b0xd_ (7b0x D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
   pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368)

4. Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families)
   automatically mapped to Pfam PF13954

5. Family b.167.1.1: Usher N-domain [141730] (1 protein)
   N-terminal part of Pfam PF00577

6. Protein Outer membrane usher protein FimD [141731] (1 species)

7. Species Escherichia coli [TaxId:562] [141732] (5 PDB entries)
   Uniprot P30130 46-170! Uniprot P30130 70-170! Uniprot P30130 70-184

8. Domain d7b0xd_: 7b0x D: [420769]
   Other proteins in same PDB: d7b0xc1, d7b0xc2, d7b0xc3, d7b0xi_
   automated match to d1ze3d1
   complexed with edo

Details for d7b0xd_

PDB Entry: 7b0x, 1.7 Å

PDB Description: crystal structure of the ternary complex of the e. coli type 1 pilus proteins fimc, fimi and the n-terminal domain of fimd

PDB Compounds: (D:) Outer membrane usher protein fimD

SCOPe Domain Sequences for d7b0xd_:

Sequence, based on SEQRES records:

>d7b0xd_ b.167.1.1 (D:) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
dlyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgi
vpcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafm
snr

Sequence, based on observed residues (ATOM records):

>d7b0xd_ b.167.1.1 (D:) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
dlyfnprflaavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgivpcl
traqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafmsnr

Timeline for d7b0xd_:

• d7b0xd_ is new in SCOPe 2.08-stable