Lineage for d7b0xi_ (7b0x I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767888Species Escherichia coli [TaxId:83333] [346217] (8 PDB entries)
  8. 3084208Domain d7b0xi_: 7b0x I: [420525]
    Other proteins in same PDB: d7b0xc1, d7b0xc2, d7b0xc3, d7b0xd_
    automated match to d6swhf_
    complexed with edo

Details for d7b0xi_

PDB Entry: 7b0x (more details), 1.7 Å

PDB Description: crystal structure of the ternary complex of the e. coli type 1 pilus proteins fimc, fimi and the n-terminal domain of fimd
PDB Compounds: (I:) Fimbrin-like protein FimI

SCOPe Domain Sequences for d7b0xi_:

Sequence, based on SEQRES records: (download)

>d7b0xi_ b.2.3.0 (I:) automated matches {Escherichia coli [TaxId: 83333]}
aetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecstvvservgvafhgva
dgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwkrlysgstslhfiakyrat
grrvtggianaqawfsltyq

Sequence, based on observed residues (ATOM records): (download)

>d7b0xi_ b.2.3.0 (I:) automated matches {Escherichia coli [TaxId: 83333]}
aetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecstvvservgvafhgva
dgknpdvlsvgegpgiatnigvalfddegnlvpinrppkrlysgstslhfiakyratgrr
vtggianaqawfsltyq

SCOPe Domain Coordinates for d7b0xi_:

Click to download the PDB-style file with coordinates for d7b0xi_.
(The format of our PDB-style files is described here.)

Timeline for d7b0xi_:

  • d7b0xi_ is new in SCOPe 2.08-stable