Lineage for d7b0xc2 (7b0x C:122-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773170Protein FimC [49588] (1 species)
  7. 2773171Species Escherichia coli [TaxId:562] [49589] (11 PDB entries)
  8. 3084202Domain d7b0xc2: 7b0x C:122-205 [420519]
    Other proteins in same PDB: d7b0xc1, d7b0xc3, d7b0xd_, d7b0xi_
    automated match to d1ze3c2
    complexed with edo

Details for d7b0xc2

PDB Entry: 7b0x (more details), 1.7 Å

PDB Description: crystal structure of the ternary complex of the e. coli type 1 pilus proteins fimc, fimi and the n-terminal domain of fimd
PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d7b0xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b0xc2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d7b0xc2:

Click to download the PDB-style file with coordinates for d7b0xc2.
(The format of our PDB-style files is described here.)

Timeline for d7b0xc2:

  • d7b0xc2 is new in SCOPe 2.08-stable