Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species) also contain an Ig-like domain |
Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [56303] (5 PDB entries) |
Domain d3kbpc2: 3kbp C:121-432 [42074] Other proteins in same PDB: d3kbpa1, d3kbpb1, d3kbpc1, d3kbpd1 complexed with fe, nag, wo4, zn |
PDB Entry: 3kbp (more details), 3 Å
SCOPe Domain Sequences for d3kbpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kbpc2 d.159.1.1 (C:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf fnrhwypvddst
Timeline for d3kbpc2: