![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family) ![]() |
![]() | Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) |
![]() | Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) |
![]() | Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (5 PDB entries) |
![]() | Domain d3kbpc1: 3kbp C:9-120 [22355] Other proteins in same PDB: d3kbpa2, d3kbpb2, d3kbpc2, d3kbpd2 complexed with fe, nag, wo4, zn |
PDB Entry: 3kbp (more details), 3 Å
SCOPe Domain Sequences for d3kbpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kbpc1 b.1.12.1 (C:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d3kbpc1: