| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) ![]() |
| Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
| Protein Proteasome alpha subunit (non-catalytic) [56255] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries) |
| Domain d1g0up_: 1g0u P: [41954] Other proteins in same PDB: d1g0u1_, d1g0u2_, d1g0uh_, d1g0ui_, d1g0uj_, d1g0uk_, d1g0ul_, d1g0um_, d1g0un_, d1g0uv_, d1g0uw_, d1g0ux_, d1g0uy_, d1g0uz_ |
PDB Entry: 1g0u (more details), 2.4 Å
SCOP Domain Sequences for d1g0up_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0up_ d.153.1.4 (P:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln
dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp
fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai
elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit
Timeline for d1g0up_:
View in 3DDomains from other chains: (mouse over for more information) d1g0u1_, d1g0u2_, d1g0ua_, d1g0ub_, d1g0uc_, d1g0ud_, d1g0ue_, d1g0uf_, d1g0ug_, d1g0uh_, d1g0ui_, d1g0uj_, d1g0uk_, d1g0ul_, d1g0um_, d1g0un_, d1g0uo_, d1g0uq_, d1g0ur_, d1g0us_, d1g0ut_, d1g0uu_, d1g0uv_, d1g0uw_, d1g0ux_, d1g0uy_, d1g0uz_ |