Lineage for d1g0uf_ (1g0u F:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197868Protein Proteasome alpha subunit (non-catalytic) [56255] (3 species)
  7. 197884Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries)
  8. 197904Domain d1g0uf_: 1g0u F: [41951]
    Other proteins in same PDB: d1g0u1_, d1g0u2_, d1g0uh_, d1g0ui_, d1g0uj_, d1g0uk_, d1g0ul_, d1g0um_, d1g0un_, d1g0uv_, d1g0uw_, d1g0ux_, d1g0uy_, d1g0uz_

Details for d1g0uf_

PDB Entry: 1g0u (more details), 2.4 Å

PDB Description: a gated channel into the proteasome core particle

SCOP Domain Sequences for d1g0uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0uf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
gydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvk
iqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtly
nsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeg
lsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqke
in

SCOP Domain Coordinates for d1g0uf_:

Click to download the PDB-style file with coordinates for d1g0uf_.
(The format of our PDB-style files is described here.)

Timeline for d1g0uf_: