Lineage for d1ai6.1 (1ai6 A:,B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548839Family d.153.1.2: Penicillin acylase, catalytic domain [56244] (3 proteins)
  6. 2548856Protein Penicillin acylase [56245] (2 species)
    also contains 2 all-alpha and a beta-barrel domains
    will be divided into domains in future release
  7. 2548857Species Escherichia coli [TaxId:562] [56246] (24 PDB entries)
  8. 2548874Domain d1ai6.1: 1ai6 A:,B: [41847]
    complexed with 4hp, ca

Details for d1ai6.1

PDB Entry: 1ai6 (more details), 2.55 Å

PDB Description: penicillin acylase with p-hydroxyphenylacetic acid
PDB Compounds: (A:) penicillin amidohydrolase, (B:) penicillin amidohydrolase

SCOPe Domain Sequences for d1ai6.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ai6.1 d.153.1.2 (A:,B:) Penicillin acylase {Escherichia coli [TaxId: 562]}
ssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgkdf
vkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfntf
gftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkwlv
npsapttiavqesnyXsnmwvigkskaqdakaimvngpqfgwyapaytygiglhgagydv
tgntpfaypglvfghngviswgstagfgddvdifaerlsaekpgyylhngkwvkmlsree
titvkngqaetftvwrtvhgnilqtdqttqtayaksrawdgkevasllawthqmkaknwq
qwtqqaakqaltinwyyadvngnigyvhtgaypdrqsghdprlpvpgtgkwdwkgllpfe
mnpkvynpqsgyianwnnspqkdypasdlfaflwggadrvteidrlleqkprltadqawd
virqtsrqdlnlrlflptlqaatsgltqsdprrqlvetltrwdginllnddgktwqqpgs
ailnvwltsmlkrtvvaavpmpfdkwysasgyettqdgptgslnisvgakilyeavqgdk
spipqavdlfagkpqqevvlaaledtwetlskrygnnvsnwktpamaltfrannffgvpq
aaaeetrhqaeyqnrgtendmivfspttsdrpvlawdvvapgqsgfiapdgtvdkhyedq
lkmyenfgrkslwltkqdveahkesqevlhvqr

SCOPe Domain Coordinates for d1ai6.1:

Click to download the PDB-style file with coordinates for d1ai6.1.
(The format of our PDB-style files is described here.)

Timeline for d1ai6.1: