PDB entry 1ai6

View 1ai6 on RCSB PDB site
Description: penicillin acylase with p-hydroxyphenylacetic acid
Class: antibiotic resistance
Keywords: antibiotic resistance, ligand induced conformational change, hydrolase
Deposited on 1997-05-01, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.137
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin amidohydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ai6.1
  • Chain 'B':
    Compound: penicillin amidohydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06875 (0-556)
      • conflict (164)
    Domains in SCOPe 2.07: d1ai6.1
  • Heterogens: CA, 4HP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ai6A (A:)
    eqssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgk
    dfvkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfn
    tfgftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkw
    lvnpsapttiavqesnyplkfnqqnsqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ai6A (A:)
    ssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgkdf
    vkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfntf
    gftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkwlv
    npsapttiavqesny
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ai6B (B:)
    snmwvigkskaqdakaimvngpqfgwyapaytygiglhgagydvtgntpfaypglvfghn
    gviswgstagfgddvdifaerlsaekpgyylhngkwvkmlsreetitvkngqaetftvwr
    tvhgnilqtdqttqtayaksrawdgkevasllawthqmkaknwqqwtqqaakqaltinwy
    yadvngnigyvhtgaypdrqsghdprlpvpgtgkwdwkgllpfemnpkvynpqsgyianw
    nnspqkdypasdlfaflwggadrvteidrlleqkprltadqawdvirqtsrqdlnlrlfl
    ptlqaatsgltqsdprrqlvetltrwdginllnddgktwqqpgsailnvwltsmlkrtvv
    aavpmpfdkwysasgyettqdgptgslnisvgakilyeavqgdkspipqavdlfagkpqq
    evvlaaledtwetlskrygnnvsnwktpamaltfrannffgvpqaaaeetrhqaeyqnrg
    tendmivfspttsdrpvlawdvvapgqsgfiapdgtvdkhyedqlkmyenfgrkslwltk
    qdveahkesqevlhvqr