Lineage for d7m8rh_ (7m8r H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978075Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2978076Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2978077Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2978116Protein automated matches [190214] (3 species)
    not a true protein
  7. 2978117Species Methylosinus trichosporium [TaxId:595536] [392646] (10 PDB entries)
  8. 2978129Domain d7m8rh_: 7m8r H: [418376]
    Other proteins in same PDB: d7m8ra_, d7m8rb_, d7m8rc_, d7m8re_, d7m8rf_, d7m8rg_
    automated match to d6vk5h_
    complexed with bez, cl, edo, fe, w6x

Details for d7m8rh_

PDB Entry: 7m8r (more details), 2.22 Å

PDB Description: complex structure of methane monooxygenase hydroxylase and regulatory subunit with fluorosubstituted tryptophans
PDB Compounds: (H:) Methane monooxygenase regulatory protein B

SCOPe Domain Sequences for d7m8rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m8rh_ d.137.1.1 (H:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
sahnaynagimqctgkafadeffaeenqvvhesnavvlvlmksdeidaiiedivlkggka
knpsivvedkagfwwikadgaieidaaeagellgkpfsvydllinvsstvgraytlgtkf
titselmgldraltdi

SCOPe Domain Coordinates for d7m8rh_:

Click to download the PDB-style file with coordinates for d7m8rh_.
(The format of our PDB-style files is described here.)

Timeline for d7m8rh_:

  • d7m8rh_ is new in SCOPe 2.08-stable