Lineage for d6vk5h_ (6vk5 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978075Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2978076Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2978077Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2978116Protein automated matches [190214] (3 species)
    not a true protein
  7. 2978117Species Methylosinus trichosporium [TaxId:595536] [392646] (10 PDB entries)
  8. 2978119Domain d6vk5h_: 6vk5 H: [392716]
    Other proteins in same PDB: d6vk5a_, d6vk5b_, d6vk5c_, d6vk5e_, d6vk5f_, d6vk5g_
    automated match to d1ckva_
    complexed with bez, cl, edo, fe

Details for d6vk5h_

PDB Entry: 6vk5 (more details), 1.86 Å

PDB Description: crystal structure of methylosinus trichosporium ob3b soluble methane monooxygenase hydroxylase and regulatory component complex
PDB Compounds: (H:) Methane monooxygenase regulatory protein B

SCOPe Domain Sequences for d6vk5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vk5h_ d.137.1.1 (H:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
ssahnaynagimqktgkafadeffaeenqvvhesnavvlvlmksdeidaiiedivlkggk
aknpsivvedkagfwwikadgaieidaaeagellgkpfsvydllinvsstvgraytlgtk
ftitselmgldraltdi

SCOPe Domain Coordinates for d6vk5h_:

Click to download the PDB-style file with coordinates for d6vk5h_.
(The format of our PDB-style files is described here.)

Timeline for d6vk5h_: