Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
Protein automated matches [190214] (3 species) not a true protein |
Species Methylosinus trichosporium [TaxId:595536] [392646] (10 PDB entries) |
Domain d6vk5h_: 6vk5 H: [392716] Other proteins in same PDB: d6vk5a_, d6vk5b_, d6vk5c_, d6vk5e_, d6vk5f_, d6vk5g_ automated match to d1ckva_ complexed with bez, cl, edo, fe |
PDB Entry: 6vk5 (more details), 1.86 Å
SCOPe Domain Sequences for d6vk5h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vk5h_ d.137.1.1 (H:) automated matches {Methylosinus trichosporium [TaxId: 595536]} ssahnaynagimqktgkafadeffaeenqvvhesnavvlvlmksdeidaiiedivlkggk aknpsivvedkagfwwikadgaieidaaeagellgkpfsvydllinvsstvgraytlgtk ftitselmgldraltdi
Timeline for d6vk5h_: