Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species) contains an extra alpha-helical domain |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385979] (354 PDB entries) |
Domain d7lcta_: 7lct A: [418287] automated match to d7n5za_ complexed with xu4 |
PDB Entry: 7lct (more details), 1.93 Å
SCOPe Domain Sequences for d7lcta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lcta_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddvvycprhvictsedmlnpnyedllir ksnhnflvqagnvqlrvighsmqncvlklkvdtanpktpkykfvriqpgqtfsvlacyng spsgvyqcamrpnftikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegn fygpfvdrqtaqaagtdttitvnvlawlyaavingdrwflnrftttlndfnlvamkynye pltqdhvdilgplsaqtgiavldmcaslkellqngmngrtilgsalledeftpfdvvrqc sgvtfq
Timeline for d7lcta_: