Lineage for d7ki9a1 (7ki9 A:1-165)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903944Protein automated matches [190514] (12 species)
    not a true protein
  7. 2903968Species Mycobacterium ulcerans [TaxId:362242] [395872] (10 PDB entries)
  8. 2903971Domain d7ki9a1: 7ki9 A:1-165 [418231]
    Other proteins in same PDB: d7ki9a2
    automated match to d6uwqa_
    complexed with nap, wfj

Details for d7ki9a1

PDB Entry: 7ki9 (more details), 1.25 Å

PDB Description: crystal structure of dihydrofolate reductase (dhfr) from mycobacterium ulcerans agy99 in complex with nadp and inhibitor sddc-0001912
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d7ki9a1:

Sequence, based on SEQRES records: (download)

>d7ki9a1 c.71.1.1 (A:1-165) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
mtsvgliwaqstsgvigrdggipwrlpedlahfkrltmghtvvmgrrtwdslpaahrplp
grrnvvvtrqtglvahgaqvvgsleqalspaepdaatwviggaqiyalalplanrcevte
vdvdlppededalapvldqtwagtsgewlvsrsglryrmhsyrrl

Sequence, based on observed residues (ATOM records): (download)

>d7ki9a1 c.71.1.1 (A:1-165) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
mtsvgliwaqstsgvigrdggipwrlpedlahfkrltmghtvvmgrrtwdslpaahrplp
grrnvvvtrqtglvahgaqvvgsleqalspaatwviggaqiyalalplanrcevtevdvd
lppededalapvldqtwagtsgewlvsrsglryrmhsyrrl

SCOPe Domain Coordinates for d7ki9a1:

Click to download the PDB-style file with coordinates for d7ki9a1.
(The format of our PDB-style files is described here.)

Timeline for d7ki9a1:

  • d7ki9a1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7ki9a2