PDB entry 7ki9

View 7ki9 on RCSB PDB site
Description: Crystal Structure of Dihydrofolate reductase (DHFR) from Mycobacterium ulcerans Agy99 in complex with NADP and inhibitor SDDC-0001912
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: SSGCID, SDDC, inhibitor, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2020-10-23, released 2021-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Mycobacterium ulcerans (strain Agy99) [TaxId:362242]
  Gene: dfrA, MUL_2179
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0PQG8 (8-172)
    • expression tag (0-7)
    • engineered mutation (96)
    • engineered mutation (103)
  Domains in SCOPe 2.08: d7ki9a1, d7ki9a2
• Heterogens: NAP, WFJ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >7ki9A (A:)
  mahhhhhhmtsvgliwaqstsgvigrdggipwrlpedlahfkrltmghtvvmgrrtwdsl
  paahrplpgrrnvvvtrqtglvahgaqvvgsleqalspaepdaatwviggaqiyalalpl
  anrcevtevdvdlppededalapvldqtwagtsgewlvsrsglryrmhsyrrl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7ki9A (A:)
  hhhhhmtsvgliwaqstsgvigrdggipwrlpedlahfkrltmghtvvmgrrtwdslpaa
  hrplpgrrnvvvtrqtglvahgaqvvgsleqalspaatwviggaqiyalalplanrcevt
  evdvdlppededalapvldqtwagtsgewlvsrsglryrmhsyrrl