SCOPe 2.08: Domain d1b4nd2: 1b4n D:1-210

Lineage for d1b4nd2 (1b4n D:1-210)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)
   contains sandwich; duplication of alpha+beta motif with single mixed sheet
   motif: beta(2)-alpha-beta(3)-alpha-beta; strand order 216345, strands 1 and 6 are parallel

4. Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family)
   automatically mapped to Pfam PF02730

5. Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins)

6. Protein Formaldehyde ferredoxin oxidoreductase [56232] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [56233] (2 PDB entries)

8. Domain d1b4nd2: 1b4n D:1-210 [41803]
   Other proteins in same PDB: d1b4na1, d1b4nb1, d1b4nc1, d1b4nd1
   complexed with ca, gua, pte, sf4

Details for d1b4nd2

PDB Entry: 1b4n, 2.4 Å

PDB Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus, complexed with glutarate

PDB Compounds: (D:) formaldehyde ferredoxin oxidoreductase

SCOPe Domain Sequences for d1b4nd2:

Sequence; same for both SEQRES and ATOM records:

>d1b4nd2 d.152.1.1 (D:1-210) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
aagrpgmgavmgskklkavvirgtkeipva

Timeline for d1b4nd2:

• d1b4nd2 first appeared (with stable ids) in SCOP 1.55
  
• d1b4nd2 appears in SCOPe 2.07