Lineage for d1b4nd1 (1b4n D:211-619)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006090Fold a.110: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48309] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006091Superfamily a.110.1: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48310] (1 family) (S)
    automatically mapped to Pfam PF01314
  5. 2006092Family a.110.1.1: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48311] (2 protein domains)
  6. 2006097Protein Formaldehyde ferredoxin oxidoreductase [48314] (1 species)
  7. 2006098Species Pyrococcus furiosus [TaxId:2261] [48315] (2 PDB entries)
  8. 2006106Domain d1b4nd1: 1b4n D:211-619 [19051]
    Other proteins in same PDB: d1b4na2, d1b4nb2, d1b4nc2, d1b4nd2
    complexed with ca, gua, pte, sf4

Details for d1b4nd1

PDB Entry: 1b4n (more details), 2.4 Å

PDB Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus, complexed with glutarate
PDB Compounds: (D:) formaldehyde ferredoxin oxidoreductase

SCOPe Domain Sequences for d1b4nd1:

Sequence, based on SEQRES records: (download)

>d1b4nd1 a.110.1.1 (D:211-619) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
dkeelkklsqeayneilnspgypfwkrqgtmaavewcntnyalptrnfsdgyfefarsid
gytmegmkvqqrgcpycnmpcgnvvldaegqeseldyenvallgsnlgigklnevsvlnr
iademgmdtislgvsiahvmeavergilkegptfgdfkgakqlaldiayrkgelgnlaae
gvkamaeklgthdfamhvkglevsgyncyiypamalaygtsaigahhkeawviaweigta
piegekaekveykisydpikaqkvvelqrlrgglfemltacrlpwvevglsldyypkllk
aitgvtytwddlykaadrvysliraywvrefngkwdrkmdyppkrwfteglksgphkgeh
ldekkydellseyyrirgwdergipkketlkeldldfvipelekvtnle

Sequence, based on observed residues (ATOM records): (download)

>d1b4nd1 a.110.1.1 (D:211-619) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
dkeelkklsqeayneilnspgypfwkrqgtmaavewcntnyalptrnfsdgyfefarsid
gytmegmkvqqrgcpycnmpcgnvvldaegqeseldyenvallgsnlgigklnevsvlnr
iademgmdtislgvsiahvmeavergilkegptfgdfkgakqlaldiayrkgelgnlaae
gvkamaeklgthdfamhvkglevsgyncyiypamalaygtsaigahhkeawviaweigta
pieykisydpikaqkvvelqrlrgglfemltacrlpwvevglsldyypkllkaitgvtyt
wddlykaadrvysliraywvrefngkwdrkmdyppkrwfteglksgphkgehldekkyde
llseyyrirgwdergipkketlkeldldfvipelekvtnle

SCOPe Domain Coordinates for d1b4nd1:

Click to download the PDB-style file with coordinates for d1b4nd1.
(The format of our PDB-style files is described here.)

Timeline for d1b4nd1: