PDB entry 1b4n

View 1b4n on RCSB PDB site
Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus, complexed with glutarate
Class: oxidoreductase
Keywords: oxidoreductase, tungstoenzyme, moco, tungsten containing protein, hyperthermophile
Deposited on 1998-12-24, released 1999-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formaldehyde ferredoxin oxidoreductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4na1, d1b4na2
  • Chain 'B':
    Compound: formaldehyde ferredoxin oxidoreductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4nb1, d1b4nb2
  • Chain 'C':
    Compound: formaldehyde ferredoxin oxidoreductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4nc1, d1b4nc2
  • Chain 'D':
    Compound: formaldehyde ferredoxin oxidoreductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4nd1, d1b4nd2
  • Heterogens: CA, SF4, GUA, PTE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b4nA (A:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapiegekaekveykisydpikaqkvvelqrl
    rgglfemltacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvre
    fngkwdrkmdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketl
    keldldfvipelekvtnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4nA (A:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapieykisydpikaqkvvelqrlrgglfeml
    tacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvrefngkwdrk
    mdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketlkeldldfv
    ipelekvtnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b4nB (B:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapiegekaekveykisydpikaqkvvelqrl
    rgglfemltacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvre
    fngkwdrkmdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketl
    keldldfvipelekvtnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4nB (B:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapieykisydpikaqkvvelqrlrgglfeml
    tacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvrefngkwdrk
    mdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketlkeldldfv
    ipelekvtnle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b4nC (C:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapiegekaekveykisydpikaqkvvelqrl
    rgglfemltacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvre
    fngkwdrkmdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketl
    keldldfvipelekvtnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4nC (C:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapieykisydpikaqkvvelqrlrgglfeml
    tacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvrefngkwdrk
    mdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketlkeldldfv
    ipelekvtnle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b4nD (D:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapiegekaekveykisydpikaqkvvelqrl
    rgglfemltacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvre
    fngkwdrkmdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketl
    keldldfvipelekvtnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4nD (D:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapieykisydpikaqkvvelqrlrgglfeml
    tacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvrefngkwdrk
    mdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketlkeldldfv
    ipelekvtnle