Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
Domain d7e4rb2: 7e4r B:244-428 [418025] Other proteins in same PDB: d7e4ra1, d7e4rb1, d7e4rc1, d7e4rd1, d7e4re_, d7e4rf1, d7e4rf2, d7e4rf3 automated match to d3rycd2 complexed with acp, ca, gdp, gtp, hz0, mes, mg |
PDB Entry: 7e4r (more details), 2.6 Å
SCOPe Domain Sequences for d7e4rb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e4rb2 d.79.2.1 (B:244-428) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
Timeline for d7e4rb2: