Lineage for d7e4rb2 (7e4r B:244-428)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959485Domain d7e4rb2: 7e4r B:244-428 [418025]
    Other proteins in same PDB: d7e4ra1, d7e4rb1, d7e4rc1, d7e4rd1, d7e4re_, d7e4rf1, d7e4rf2, d7e4rf3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gtp, hz0, mes, mg

Details for d7e4rb2

PDB Entry: 7e4r (more details), 2.6 Å

PDB Description: crystal structure of tubulin in complex with d-dm1-sme
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d7e4rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e4rb2 d.79.2.1 (B:244-428) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d7e4rb2:

Click to download the PDB-style file with coordinates for d7e4rb2.
(The format of our PDB-style files is described here.)

Timeline for d7e4rb2:

  • d7e4rb2 is new in SCOPe 2.08-stable