SCOPe 2.08: Domain d7e4rb1: 7e4r B:2-243

Lineage for d7e4rb1 (7e4r B:2-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d7e4rb1: 7e4r B:2-243 [418024]
   Other proteins in same PDB: d7e4ra2, d7e4rb2, d7e4rc2, d7e4rd2, d7e4re_, d7e4rf1, d7e4rf2, d7e4rf3
   automated match to d4drxb1
   complexed with acp, ca, gdp, gtp, hz0, mes, mg

Details for d7e4rb1

PDB Entry: 7e4r, 2.6 Å

PDB Description: crystal structure of tubulin in complex with d-dm1-sme

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d7e4rb1:

Sequence; same for both SEQRES and ATOM records:

>d7e4rb1 c.32.1.1 (B:2-243) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d7e4rb1:

• d7e4rb1 is new in SCOPe 2.08-stable