Lineage for d1de8a_ (1de8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988163Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 2988164Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries)
  8. 2988187Domain d1de8a_: 1de8 A: [41788]
    protein/DNA complex

Details for d1de8a_

PDB Entry: 1de8 (more details), 2.95 Å

PDB Description: human apurinic/apyrimidinic endonuclease-1 (ape1) bound to abasic dna
PDB Compounds: (A:) major apurinic/apyrimidinic endonuclease

SCOPe Domain Sequences for d1de8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de8a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d1de8a_:

Click to download the PDB-style file with coordinates for d1de8a_.
(The format of our PDB-style files is described here.)

Timeline for d1de8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1de8b_