PDB entry 1de8

View 1de8 on RCSB PDB site
Description: human apurinic/apyrimidinic endonuclease-1 (ape1) bound to abasic DNA
Class: lyase/DNA
Keywords: enzyme:DNA complex, DNA repair, abasic site, lyase/DNA complex
Deposited on 1999-11-13, released 2000-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.19
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major apurinic/apyrimidinic endonuclease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1de8a_
  • Chain 'B':
    Compound: major apurinic/apyrimidinic endonuclease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1de8b_
  • Chain 'U':
    Compound: DNA (5'-d(*gp*cp*tp*ap*cp*(3dr)p*gp*ap*tp*cp*g)-3')
  • Chain 'V':
    Compound: DNA (5'-d(*cp*gp*ap*tp*cp*gp*gp*tp*ap*gp*c)-3')
  • Chain 'X':
    Compound: DNA (5'-d(*gp*cp*tp*ap*cp*(3dr)p*gp*ap*tp*cp*g)-3')
  • Chain 'Y':
    Compound: DNA (5'-d(*cp*gp*ap*tp*cp*gp*gp*tp*ap*gp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de8A (A:)
    alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
    dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
    pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
    dyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de8B (B:)
    alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
    dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
    pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
    dyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.