Lineage for d1de8a_ (1de8 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36561Fold d.151: DNase I-like [56218] (1 superfamily)
  4. 36562Superfamily d.151.1: DNase I-like [56219] (1 family) (S)
  5. 36563Family d.151.1.1: DNase I-like [56220] (3 proteins)
  6. Protein DNA repair endonuclease Hap1 [56223] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56224] (6 PDB entries)
  8. 36580Domain d1de8a_: 1de8 A: [41788]

Details for d1de8a_

PDB Entry: 1de8 (more details), 2.95 Å

PDB Description: human apurinic/apyrimidinic endonuclease-1 (ape1) bound to abasic dna

SCOP Domain Sequences for d1de8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de8a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens)}
alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

SCOP Domain Coordinates for d1de8a_:

Click to download the PDB-style file with coordinates for d1de8a_.
(The format of our PDB-style files is described here.)

Timeline for d1de8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1de8b_