Lineage for d1diqb2 (1diq B:7-242)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735500Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 735501Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 735502Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins)
  6. 735517Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species)
    the other subunit is a short-chain cytochrome c
  7. 735518Species Pseudomonas putida [TaxId:303] [56181] (4 PDB entries)
  8. 735523Domain d1diqb2: 1diq B:7-242 [41743]
    Other proteins in same PDB: d1diqa1, d1diqb1, d1diqc_, d1diqd_

Details for d1diqb2

PDB Entry: 1diq (more details), 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound
PDB Compounds: (B:) p-cresol methylhydroxylase

SCOP Domain Sequences for d1diqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diqb2 d.145.1.1 (B:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

SCOP Domain Coordinates for d1diqb2:

Click to download the PDB-style file with coordinates for d1diqb2.
(The format of our PDB-style files is described here.)

Timeline for d1diqb2: