Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families) duplication: contains two subdomains of this fold |
Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins) |
Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species) the other subunit is a short-chain cytochrome c |
Species Pseudomonas putida [TaxId:303] [55108] (4 PDB entries) |
Domain d1diqb1: 1diq B:243-521 [39480] Other proteins in same PDB: d1diqa2, d1diqb2, d1diqc_, d1diqd_ |
PDB Entry: 1diq (more details), 2.75 Å
SCOP Domain Sequences for d1diqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diqb1 d.58.32.1 (B:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr vaqsygpvkrklehaikravdpnnilapgrsgidlnndf
Timeline for d1diqb1:
View in 3D Domains from other chains: (mouse over for more information) d1diqa1, d1diqa2, d1diqc_, d1diqd_ |