Lineage for d1diqd_ (1diq D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 634089Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
    the other subunit is a flavoprotein
  7. 634090Species Pseudomonas putida [TaxId:303] [46670] (3 PDB entries)
  8. 634094Domain d1diqd_: 1diq D: [15924]
    Other proteins in same PDB: d1diqa1, d1diqa2, d1diqb1, d1diqb2

Details for d1diqd_

PDB Entry: 1diq (more details), 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound
PDB Compounds: (D:) p-cresol methylhydroxylase

SCOP Domain Sequences for d1diqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diqd_ a.3.1.1 (D:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa

SCOP Domain Coordinates for d1diqd_:

Click to download the PDB-style file with coordinates for d1diqd_.
(The format of our PDB-style files is described here.)

Timeline for d1diqd_: