| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
| Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species) the other subunit is a flavoprotein |
| Species Pseudomonas putida [TaxId:303] [46670] (3 PDB entries) |
| Domain d1diqd_: 1diq D: [15924] Other proteins in same PDB: d1diqa1, d1diqa2, d1diqb1, d1diqb2 |
PDB Entry: 1diq (more details), 2.75 Å
SCOP Domain Sequences for d1diqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diqd_ a.3.1.1 (D:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa
Timeline for d1diqd_: