Lineage for d1e8xa4 (1e8x A:726-1092)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218054Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 2218055Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2218122Species Pig (Sus scrofa) [TaxId:9823] [56173] (6 PDB entries)
  8. 2218125Domain d1e8xa4: 1e8x A:726-1092 [41711]
    Other proteins in same PDB: d1e8xa1, d1e8xa2, d1e8xa3, d1e8xa5
    complexed with atp, lu

Details for d1e8xa4

PDB Entry: 1e8x (more details), 2.2 Å

PDB Description: structural insights into phoshoinositide 3-kinase enzymatic mechanism and signalling
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOPe Domain Sequences for d1e8xa4:

Sequence, based on SEQRES records: (download)

>d1e8xa4 d.144.1.4 (A:726-1092) Phoshoinositide 3-kinase (PI3K), catalytic domain {Pig (Sus scrofa) [TaxId: 9823]}
tamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrv
pydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfn
wflhlvl

Sequence, based on observed residues (ATOM records): (download)

>d1e8xa4 d.144.1.4 (A:726-1092) Phoshoinositide 3-kinase (PI3K), catalytic domain {Pig (Sus scrofa) [TaxId: 9823]}
tamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrv
pydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidf
ghvpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmp
qltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvl

SCOPe Domain Coordinates for d1e8xa4:

Click to download the PDB-style file with coordinates for d1e8xa4.
(The format of our PDB-style files is described here.)

Timeline for d1e8xa4: