Lineage for d1e8xa4 (1e8x A:726-1092)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36445Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 36446Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 36451Species Pig (Sus scrofa) [TaxId:9823] [56173] (5 PDB entries)
  8. 36453Domain d1e8xa4: 1e8x A:726-1092 [41711]
    Other proteins in same PDB: d1e8xa1, d1e8xa2, d1e8xa3

Details for d1e8xa4

PDB Entry: 1e8x (more details), 2.2 Å

PDB Description: structural insights into phoshoinositide 3-kinase enzymatic mechanism and signalling
PDB Compounds: (A:)

SCOP Domain Sequences for d1e8xa4:

Sequence, based on SEQRES records: (download)

>d1e8xa4 d.144.1.4 (A:726-1092) Phoshoinositide 3-kinase (PI3K), catalytic domain {Pig (Sus scrofa)}
tamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrv
pydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfn
wflhlvl

Sequence, based on observed residues (ATOM records): (download)

>d1e8xa4 d.144.1.4 (A:726-1092) Phoshoinositide 3-kinase (PI3K), catalytic domain {Pig (Sus scrofa)}
tamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrv
pydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidf
ghvpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmp
qltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvl

SCOP Domain Coordinates for d1e8xa4:

Click to download the PDB-style file with coordinates for d1e8xa4.
(The format of our PDB-style files is described here.)

Timeline for d1e8xa4: