Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
Protein automated matches [190133] (8 species) not a true protein |
Species Clostridioides difficile [TaxId:1496] [420073] (3 PDB entries) |
Domain d6x6wb2: 6x6w B:217-420 [417035] Other proteins in same PDB: d6x6wb1 automated match to d1giqa2 |
PDB Entry: 6x6w (more details), 1.89 Å
SCOPe Domain Sequences for d6x6wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x6wb2 d.166.1.1 (B:217-420) automated matches {Clostridioides difficile [TaxId: 1496]} sldfkddvskgdswgkanyndwsnkltpneladvndymrggytainnylisngpvnnpnp eldskitnienalkrepiptnltvyrrsgpqefgltltspeydfnklenidafkskwegq alsypnfistsigsvnmsafakrkivlritipkgspgaylsaipgyageyevllnhgskf kinkidsykdgtitklivdatlip
Timeline for d6x6wb2: