Lineage for d6x6wb2 (6x6w B:217-420)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000572Protein automated matches [190133] (8 species)
    not a true protein
  7. 3000592Species Clostridioides difficile [TaxId:1496] [420073] (3 PDB entries)
  8. 3000595Domain d6x6wb2: 6x6w B:217-420 [417035]
    Other proteins in same PDB: d6x6wb1
    automated match to d1giqa2

Details for d6x6wb2

PDB Entry: 6x6w (more details), 1.89 Å

PDB Description: crystal structure of inactive enzymatic binary toxin component from clostridium difficile
PDB Compounds: (B:) ADP-ribosyltransferase

SCOPe Domain Sequences for d6x6wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x6wb2 d.166.1.1 (B:217-420) automated matches {Clostridioides difficile [TaxId: 1496]}
sldfkddvskgdswgkanyndwsnkltpneladvndymrggytainnylisngpvnnpnp
eldskitnienalkrepiptnltvyrrsgpqefgltltspeydfnklenidafkskwegq
alsypnfistsigsvnmsafakrkivlritipkgspgaylsaipgyageyevllnhgskf
kinkidsykdgtitklivdatlip

SCOPe Domain Coordinates for d6x6wb2:

Click to download the PDB-style file with coordinates for d6x6wb2.
(The format of our PDB-style files is described here.)

Timeline for d6x6wb2:

  • d6x6wb2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6x6wb1