Lineage for d1ir3a_ (1ir3 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220877Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 1220878Species Human (Homo sapiens) [TaxId:9606] [56163] (15 PDB entries)
  8. 1220880Domain d1ir3a_: 1ir3 A: [41702]
    complexed with anp, mg

Details for d1ir3a_

PDB Entry: 1ir3 (more details), 1.9 Å

PDB Description: phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and atp analog
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d1ir3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir3a_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
enk

SCOPe Domain Coordinates for d1ir3a_:

Click to download the PDB-style file with coordinates for d1ir3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ir3a_: