Lineage for d1ir3a_ (1ir3 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36394Family d.144.1.2: Tyrosine kinase [56150] (8 proteins)
  6. 36425Protein Insulin receptor [56162] (1 species)
  7. 36426Species Human (Homo sapiens) [TaxId:9606] [56163] (3 PDB entries)
  8. 36427Domain d1ir3a_: 1ir3 A: [41702]

Details for d1ir3a_

PDB Entry: 1ir3 (more details), 1.9 Å

PDB Description: phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and atp analog

SCOP Domain Sequences for d1ir3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir3a_ d.144.1.2 (A:) Insulin receptor {Human (Homo sapiens)}
ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
enk

SCOP Domain Coordinates for d1ir3a_:

Click to download the PDB-style file with coordinates for d1ir3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ir3a_: