Lineage for d1b6cf_ (1b6c F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043533Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 1043534Species Human (Homo sapiens) [TaxId:9606] [56145] (8 PDB entries)
    Uniprot P36897 200-500 ! Uniprot P36897 201-503
  8. 1043543Domain d1b6cf_: 1b6c F: [41675]
    Other proteins in same PDB: d1b6ca_, d1b6cc_, d1b6ce_, d1b6cg_
    complexed with so4

Details for d1b6cf_

PDB Entry: 1b6c (more details), 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12
PDB Compounds: (F:) tgf-b superfamily receptor type I

SCOPe Domain Sequences for d1b6cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6cf_ d.144.1.7 (F:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
ttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeevavkif
ssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnr
ytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtcciadlgl
avrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarr
csiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrec
wyangaarltalrikktlsqlsqqeg

SCOPe Domain Coordinates for d1b6cf_:

Click to download the PDB-style file with coordinates for d1b6cf_.
(The format of our PDB-style files is described here.)

Timeline for d1b6cf_: