Lineage for d6r77b_ (6r77 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939665Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2939666Protein automated matches [190491] (18 species)
    not a true protein
  7. 2939750Species Thermococcus litoralis [TaxId:523849] [365392] (3 PDB entries)
  8. 2939752Domain d6r77b_: 6r77 B: [416509]
    automated match to d6r76b_
    complexed with hy3

Details for d6r77b_

PDB Entry: 6r77 (more details), 2 Å

PDB Description: crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation
PDB Compounds: (B:) proline racemase

SCOPe Domain Sequences for d6r77b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r77b_ d.21.1.0 (B:) automated matches {Thermococcus litoralis [TaxId: 523849]}
mfkklenlekweppkdwmviktldthtageplriilsgfpeipgktilekrrylmenldh
lrkalmweprghadmygaiitepvseeadfgvifmhnegystmcghatialgkvavecgl
veakepiteikmdspaglikiyvkvrdgkvekvyfhnvpsfvlfkdetinvpgigevkyd
layggafyafvnaeeiglkctpeyyrqlidvgmkikraimsekeirhpfeedlsflygti
figepedenshsrhvcifadgevdrsptgtgvsarlailyekgeidigeeitiesiigtk
ftgkvveetryglyraiipevggnayivakntflidpqdplkygfflr

SCOPe Domain Coordinates for d6r77b_:

Click to download the PDB-style file with coordinates for d6r77b_.
(The format of our PDB-style files is described here.)

Timeline for d6r77b_:

  • d6r77b_ is new in SCOPe 2.08-stable