SCOPe 2.08: Domain d6r77a_: 6r77 A:

Lineage for d6r77a_ (6r77 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Thermococcus litoralis [TaxId:523849] [365392] (3 PDB entries)

8. Domain d6r77a_: 6r77 A: [416508]
   automated match to d6r76b_
   complexed with hy3

Details for d6r77a_

PDB Entry: 6r77, 2 Å

PDB Description: crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation

PDB Compounds: (A:) proline racemase

SCOPe Domain Sequences for d6r77a_:

Sequence; same for both SEQRES and ATOM records:

>d6r77a_ d.21.1.0 (A:) automated matches {Thermococcus litoralis [TaxId: 523849]}
mfkklenlekweppkdwmviktldthtageplriilsgfpeipgktilekrrylmenldh
lrkalmweprghadmygaiitepvseeadfgvifmhnegystmcghatialgkvavecgl
veakepiteikmdspaglikiyvkvrdgkvekvyfhnvpsfvlfkdetinvpgigevkyd
layggafyafvnaeeiglkctpeyyrqlidvgmkikraimsekeirhpfeedlsflygti
figepedenshsrhvcifadgevdrsptgtgvsarlailyekgeidigeeitiesiigtk
ftgkvveetryglyraiipevggnayivakntflidpqdplkygfflr

Timeline for d6r77a_:

• d6r77a_ is new in SCOPe 2.08-stable