SCOPe 2.08: Domain d6jb0a1: 6jb0 A:3-402

Lineage for d6jb0a1 (6jb0 A:3-402)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [420023] (34 PDB entries)

8. Domain d6jb0a1: 6jb0 A:3-402 [416232]
   Other proteins in same PDB: d6jb0a2
   automated match to d6dtqa_
   complexed with cit, edo, glc, gol, pdo; mutant

Details for d6jb0a1

PDB Entry: 6jb0, 1.63 Å

PDB Description: crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose

PDB Compounds: (A:) ABC transporter, periplasmic substrate-binding protein

SCOPe Domain Sequences for d6jb0a1:

Sequence; same for both SEQRES and ATOM records:

>d6jb0a1 c.94.1.0 (A:3-402) automated matches {Thermus thermophilus [TaxId: 300852]}
gpvirvagdstavgeggrwmkemveawgkktgtrveyidspadtndrlalyqqywaarsp
dvdvymidviwpgivaphaldlkpylteaelkeffprivqnntirgkltslpfftdagil
yyrkdllekygytspprtwneleqmaervmegerragnrdfwgfvfqgkpyegltcdale
wiyshgggrivepdgtisvnngraalalnrahgwvgriapqgvtsyaeeearnvwqqgns
lfmrnwpyayalgqaegspirgkfgvtvlpkasadapnaatlggaqlmvsaysrypkeav
dlvkylasyevqkdnavrlsrlptrpalytdrdvlarnpwfrdllpvfqnavsrpsdvag
arynqvseaiwtevhsvltgrkkgeqavrdlearirrilr

Timeline for d6jb0a1:

• d6jb0a1 is new in SCOPe 2.08-stable