Lineage for d1cmke_ (1cmk E:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512073Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 512106Species Pig (Sus scrofa) [TaxId:9823] [56117] (3 PDB entries)
  8. 512110Domain d1cmke_: 1cmk E: [41623]

Details for d1cmke_

PDB Entry: 1cmk (more details), 2.9 Å

PDB Description: crystal structures of the myristylated catalytic subunit of camp-dependent protein kinase reveal open and closed conformations

SCOP Domain Sequences for d1cmke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmke_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa)}
gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
khketgnhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvm
eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOP Domain Coordinates for d1cmke_:

Click to download the PDB-style file with coordinates for d1cmke_.
(The format of our PDB-style files is described here.)

Timeline for d1cmke_: