SCOP 1.71: Domain d1cmke_: 1cmk E:

Lineage for d1cmke_ (1cmk E:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Pig (Sus scrofa) [TaxId:9823] [56117] (3 PDB entries)

8. Domain d1cmke_: 1cmk E: [41623]
   complexed with i i, myr, po4

Details for d1cmke_

PDB Entry: 1cmk, 2.9 Å

PDB Description: crystal structures of the myristylated catalytic subunit of camp-dependent protein kinase reveal open and closed conformations

SCOP Domain Sequences for d1cmke_:

Sequence; same for both SEQRES and ATOM records:

>d1cmke_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa)}
gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
khketgnhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvm
eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d1cmke_:

• d1cmke_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmke_ appears in SCOP 1.69
  
• d1cmke_ appears in SCOP 1.73
  
• d1cmke_ appears in the current release, SCOPe 2.08