Lineage for d6ijj3_ (6ijj 3:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028425Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 3028426Protein automated matches [276200] (4 species)
    not a true protein
  7. 3028445Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries)
  8. 3028479Domain d6ijj3_: 6ijj 3: [416110]
    Other proteins in same PDB: d6ijja_, d6ijjb_, d6ijjc_, d6ijjd_, d6ijje_, d6ijjf_, d6ijjj_, d6ijjl_
    automated match to d6yac2_
    complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat

Details for d6ijj3_

PDB Entry: 6ijj (more details), 2.89 Å

PDB Description: photosystem i of chlamydomonas reinhardtii
PDB Compounds: (3:) lhca3

SCOPe Domain Sequences for d6ijj3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ijj3_ f.43.1.0 (3:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
qlyvgasqsslayldgslpgdfgfdplglldpvnsggfiepkwlqyseviharwamlgaa
gciapevlgaaglipdatnikwfesgvippagsyngywadpytiffveivamqfaelrrl
qdfrypgsmgqqyflgleaifkgsgdaaypggpffnlfnlgkteaamkelklkeikngrl
amlamlgygaqavmtgkgpfqnlvehladpvnnniltnfag

SCOPe Domain Coordinates for d6ijj3_:

Click to download the PDB-style file with coordinates for d6ijj3_.
(The format of our PDB-style files is described here.)

Timeline for d6ijj3_:

  • d6ijj3_ is new in SCOPe 2.08-stable