Lineage for d6ijjf_ (6ijj F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026109Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 3026136Family f.23.16.0: automated matches [276195] (1 protein)
    not a true family
  6. 3026137Protein automated matches [276199] (5 species)
    not a true protein
  7. 3026145Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370452] (7 PDB entries)
  8. 3026150Domain d6ijjf_: 6ijj F: [416119]
    Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjc_, d6ijjd_, d6ijje_, d6ijjj_, d6ijjl_
    automated match to d7dz7f_
    complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat

Details for d6ijjf_

PDB Entry: 6ijj (more details), 2.89 Å

PDB Description: photosystem i of chlamydomonas reinhardtii
PDB Compounds: (F:) PsaF

SCOPe Domain Sequences for d6ijjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ijjf_ f.23.16.0 (F:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
diagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyakag
llcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakptd
keiiidvplatklawqgagwplaavqelqrgtllekeenitvsp

SCOPe Domain Coordinates for d6ijjf_:

Click to download the PDB-style file with coordinates for d6ijjf_.
(The format of our PDB-style files is described here.)

Timeline for d6ijjf_:

  • d6ijjf_ is new in SCOPe 2.08-stable