Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) automatically mapped to Pfam PF02507 |
Family f.23.16.0: automated matches [276195] (1 protein) not a true family |
Protein automated matches [276199] (5 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370452] (7 PDB entries) |
Domain d6ijjf_: 6ijj F: [416119] Other proteins in same PDB: d6ijj1_, d6ijj3_, d6ijj4_, d6ijj7_, d6ijj8_, d6ijja_, d6ijjb_, d6ijjc_, d6ijjd_, d6ijje_, d6ijjj_, d6ijjl_ automated match to d7dz7f_ complexed with bcr, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, xat |
PDB Entry: 6ijj (more details), 2.89 Å
SCOPe Domain Sequences for d6ijjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ijjf_ f.23.16.0 (F:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} diagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyakag llcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakptd keiiidvplatklawqgagwplaavqelqrgtllekeenitvsp
Timeline for d6ijjf_: