Lineage for d6gfma1 (6gfm A:1-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956393Superfamily d.58.65: DUF4478 domain-like [418755] (2 families) (S)
  5. 2956410Family d.58.65.0: automated matches [418878] (1 protein)
    not a true family
  6. 2956411Protein automated matches [419242] (2 species)
    not a true protein
  7. 2956412Species Escherichia coli [TaxId:83333] [420013] (2 PDB entries)
  8. 2956415Domain d6gfma1: 6gfm A:1-141 [416005]
    Other proteins in same PDB: d6gfma2, d6gfma3, d6gfma4
    automated match to d2pmba2
    complexed with 0o2

Details for d6gfma1

PDB Entry: 6gfm (more details), 2.77 Å

PDB Description: crystal structure of the escherichia coli nucleosidase ppnn (pppgpp- form)
PDB Compounds: (A:) Pyrimidine/purine nucleotide 5'-monophosphate nucleosidase

SCOPe Domain Sequences for d6gfma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfma1 d.58.65.0 (A:1-141) automated matches {Escherichia coli [TaxId: 83333]}
ithisplgsmdmlsqlevdmlkrtassdlyqlfrncslavlnsgsltdnskellsrfenf
dinvlrrergvklelinppeeafvdgriiralqanlfavlrdilfvygqihntvrfpnln
ldnsvhitnlvfsilrnaral

SCOPe Domain Coordinates for d6gfma1:

Click to download the PDB-style file with coordinates for d6gfma1.
(The format of our PDB-style files is described here.)

Timeline for d6gfma1:

  • d6gfma1 is new in SCOPe 2.08-stable