Lineage for d2pmba2 (2pmb A:7-144)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956393Superfamily d.58.65: DUF4478 domain-like [418755] (2 families) (S)
  5. 2956394Family d.58.65.1: DUF4478 domain [418831] (1 protein)
    Pfam PF14793, often followed by Pfam PF03641 and Pfam PF11892
    Pfam PF11892, often follows Pfam PF14793 with Pfam PF03641
  6. 2956395Protein Nucleosidase PpnN [419154] (2 species)
  7. 2956405Species Vibrio cholerae [TaxId:666] [419676] (1 PDB entry)
  8. 2956406Domain d2pmba2: 2pmb A:7-144 [412912]
    Other proteins in same PDB: d2pmba1, d2pmba3, d2pmba4, d2pmbb2, d2pmbb3, d2pmbb4, d2pmbc2, d2pmbc3, d2pmbc4, d2pmbd2, d2pmbd3, d2pmbd4
    complexed with gol, po4

Details for d2pmba2

PDB Entry: 2pmb (more details), 1.99 Å

PDB Description: crystal structure of predicted nucleotide-binding protein from vibrio cholerae
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2pmba2:

Sequence, based on SEQRES records: (download)

>d2pmba2 d.58.65.1 (A:7-144) Nucleosidase PpnN {Vibrio cholerae [TaxId: 666]}
iiqvspagsmdllsqleverlkktassdlyqlyrncslavlnsgshtdnskelldkyknf
ditvmrrergiklelanppehafvdgqiikgiqehlfsvlrdivyvnmhladsqrlnltn
athitnlvfgilrnagal

Sequence, based on observed residues (ATOM records): (download)

>d2pmba2 d.58.65.1 (A:7-144) Nucleosidase PpnN {Vibrio cholerae [TaxId: 666]}
iiqvspsmdllsqleverlkktassdlyqlyrncslavlnstdnskelldkyknfditvm
rrergiklelanppehafvdgqiikgiqehlfsvlrdivyvnmhlnathitnlvfgilrn
agal

SCOPe Domain Coordinates for d2pmba2:

Click to download the PDB-style file with coordinates for d2pmba2.
(The format of our PDB-style files is described here.)

Timeline for d2pmba2:

  • d2pmba2 is new in SCOPe 2.08-stable