![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.0: automated matches [191412] (1 protein) not a true family |
![]() | Protein automated matches [190568] (10 species) not a true protein |
![]() | Species Thermomonospora curvata [TaxId:2020] [419993] (1 PDB entry) |
![]() | Domain d5yzvb_: 5yzv B: [415615] automated match to d6id1e_ |
PDB Entry: 5yzv (more details), 2.6 Å
SCOPe Domain Sequences for d5yzvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yzvb_ b.69.4.0 (B:) automated matches {Thermomonospora curvata [TaxId: 2020]} neprilttdreavavafspggsllaggsgdklihvwdvasgdelhtleghtdwvravafs pdgallasgsddatvrlwdvaaaeeravfeghthyvldiafspdgsmvasgsrdgtarlw nvatgtehavlkghtdyvyavafspdgsmvasgsrdgtirlwdvatgkerdvlqapaenv vslafspdgsmlvhgsdstvhlwdvasgealhtfeghtdwvravafspdgallasgsddr tirlwdvaaqeehttleghtepvhsvafhpegttlasasedgtiriwp
Timeline for d5yzvb_:
![]() Domains from other chains: (mouse over for more information) d5yzva_, d5yzvc_, d5yzvd_, d5yzve_ |